|
|
revseq |
It can also output just the reversed sequence or just the complement of the sequence.
To create the reverse complement (reverse sense) of 'tembl:hsfau' in the file 'hsfau.rev':
% revseq tembl:hsfau hsfau.rev Reverse and complement a sequence |
Go to the input files for this example
Go to the output files for this example
Example 2
To create the complement of 'tembl:hsfau' in the file 'hsfau.rev':
% revseq tembl:hsfau hsfau.rev -norev Reverse and complement a sequence |
Go to the output files for this example
Example 3
To create the reverse of 'tembl:hsfau' in the file 'hsfau.rev':
% revseq tembl:hsfau hsfau.rev -nocomp Reverse and complement a sequence |
Go to the output files for this example
Standard (Mandatory) qualifiers:
[-sequence] seqall (Gapped) nucleotide sequence(s) filename and
optional format, or reference (input USA)
[-outseq] seqoutall [
|
| Standard (Mandatory) qualifiers | Allowed values | Default | |
|---|---|---|---|
| [-sequence] (Parameter 1) |
(Gapped) nucleotide sequence(s) filename and optional format, or reference (input USA) | Readable sequence(s) | Required |
| [-outseq] (Parameter 2) |
Sequence set(s) filename and optional format (output USA) | Writeable sequence(s) | <*>.format |
| Additional (Optional) qualifiers | Allowed values | Default | |
| (none) | |||
| Advanced (Unprompted) qualifiers | Allowed values | Default | |
| -[no]reverse | Set this to be false if you do not wish to reverse the output sequence | Boolean value Yes/No | Yes |
| -[no]complement | Set this to be false if you do not wish to complement the output sequence | Boolean value Yes/No | Yes |
ID HSFAU standard; RNA; HUM; 518 BP.
XX
AC X65923;
XX
SV X65923.1
XX
DT 13-MAY-1992 (Rel. 31, Created)
DT 23-SEP-1993 (Rel. 37, Last updated, Version 10)
XX
DE H.sapiens fau mRNA
XX
KW fau gene.
XX
OS Homo sapiens (human)
OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC Eutheria; Primates; Catarrhini; Hominidae; Homo.
XX
RN [1]
RP 1-518
RA Michiels L.M.R.;
RT ;
RL Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.
RL L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,
RL Universiteisplein 1, 2610 Wilrijk, BELGIUM
XX
RN [2]
RP 1-518
RX MEDLINE; 93368957.
RA Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;
RT " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed as
RT an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";
RL Oncogene 8:2537-2546(1993).
XX
DR SWISS-PROT; P35544; UBIM_HUMAN.
DR SWISS-PROT; Q05472; RS30_HUMAN.
XX
FH Key Location/Qualifiers
FH
FT source 1..518
FT /chromosome="11q"
FT /db_xref="taxon:9606"
FT /organism="Homo sapiens"
FT /tissue_type="placenta"
FT /clone_lib="cDNA"
FT /clone="pUIA 631"
FT /map="13"
FT misc_feature 57..278
FT /note="ubiquitin like part"
FT CDS 57..458
FT /db_xref="SWISS-PROT:P35544"
FT /db_xref="SWISS-PROT:Q05472"
FT /gene="fau"
FT /protein_id="CAA46716.1"
FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAG
FT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTG
FT RAKRRMQYNRRFVNVVPTFGKKKGPNANS"
FT misc_feature 98..102
FT /note="nucleolar localization signal"
FT misc_feature 279..458
FT /note="S30 part"
FT polyA_signal 484..489
FT polyA_site 509
XX
SQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;
ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 60
agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 120
cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 180
tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 240
tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 300
gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 360
agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 420
cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 480
tctaataaaa aagccactta gttcagtcaa aaaaaaaa 518
//
|
>HSFAU X65923.1 H.sapiens fau mRNA ttttttttttgactgaactaagtggcttttttattagagaaagccagaattacaaaagac ttaagagttggcattggggcccttcttcttgccaaaggtgggcacaacgttgacaaagcg ccggttgtactgcatccgccgcttagcccgacctgtcttcttcttcttcttctcctgttt ggccaccttaggagtctgacctctcacttttccagcacgggccagggaaccatgaacttt acctccaagcatgcggcctgctacttccagggtagtcagggcctccaccccgcactggcc cagagtggcctcatcctccaggggcgcgcctgccaggagcacgacttgatcttccggggc aatgccctccagtgaggctacatgagccttgatctgggcgaccgtttcctggccggtcac ctcgaaggtgtgtagctcctgggcgcggacaaagagctgcatattggcgactgaacggcg gtcccagctaccgcgaagatggagtcgagaaagaggaa |
>HSFAU X65923.1 H.sapiens fau mRNA aaggagaaagagctgaggtagaagcgccatcgaccctggcggcaagtcagcggttatacg tcgagaaacaggcgcgggtcctcgatgtgtggaagctccactggccggtcctttgccagc gggtctagttccgagtacatcggagtgacctcccgtaacggggccttctagttcagcacg aggaccgtccgcgcggggacctcctactccggtgagacccggtcacgccccacctccggg actgatgggaccttcatcgtccggcgtacgaacctccatttcaagtaccaagggaccggg cacgaccttttcactctccagtctgaggattccaccggtttgtcctcttcttcttcttct tctgtccagcccgattcgccgcctacgtcatgttggccgcgaaacagttgcaacacgggt ggaaaccgttcttcttcccggggttacggttgagaattcagaaaacattaagaccgaaag agattattttttcggtgaatcaagtcagtttttttttt |
>HSFAU X65923.1 H.sapiens fau mRNA aaaaaaaaaactgacttgattcaccgaaaaaataatctctttcggtcttaatgttttctg aattctcaaccgtaaccccgggaagaagaacggtttccacccgtgttgcaactgtttcgc ggccaacatgacgtaggcggcgaatcgggctggacagaagaagaagaagaagaggacaaa ccggtggaatcctcagactggagagtgaaaaggtcgtgcccggtcccttggtacttgaaa tggaggttcgtacgccggacgatgaaggtcccatcagtcccggaggtggggcgtgaccgg gtctcaccggagtaggaggtccccgcgcggacggtcctcgtgctgaactagaaggccccg ttacgggaggtcactccgatgtactcggaactagacccgctggcaaaggaccggccagtg gagcttccacacatcgaggacccgcgcctgtttctcgacgtataaccgctgacttgccgc cagggtcgatggcgcttctacctcagctctttctcctt |
None.
| Program name | Description |
|---|---|
| biosed | Replace or delete sequence sections |
| codcopy | Reads and writes a codon usage table |
| cutseq | Removes a specified section from a sequence |
| degapseq | Removes gap characters from sequences |
| descseq | Alter the name or description of a sequence |
| entret | Reads and writes (returns) flatfile entries |
| extractalign | Extract regions from a sequence alignment |
| extractfeat | Extract features from a sequence |
| extractseq | Extract regions from a sequence |
| listor | Write a list file of the logical OR of two sets of sequences |
| makenucseq | Creates random nucleotide sequences |
| makeprotseq | Creates random protein sequences |
| maskfeat | Mask off features of a sequence |
| maskseq | Mask off regions of a sequence |
| newseq | Type in a short new sequence |
| noreturn | Removes carriage return from ASCII files |
| notseq | Exclude a set of sequences and write out the remaining ones |
| nthseq | Writes one sequence from a multiple set of sequences |
| pasteseq | Insert one sequence into another |
| seqret | Reads and writes (returns) sequences |
| seqretsplit | Reads and writes (returns) sequences in individual files |
| skipseq | Reads and writes (returns) sequences, skipping first few |
| splitter | Split a sequence into (overlapping) smaller sequences |
| trimest | Trim poly-A tails off EST sequences |
| trimseq | Trim ambiguous bits off the ends of sequences |
| union | Reads sequence fragments and builds one sequence |
| vectorstrip | Strips out DNA between a pair of vector sequences |
| yank | Reads a sequence range, appends the full USA to a list file |